PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_31433-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 429aa    MW: 48184.6 Da    PI: 4.9058
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_31433-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.2e-12264310147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+ WT+eE++ ++ + + +G g+Wk I++++ +++t+ q+ s+ qk+
  TRIUR3_31433-P1 264 RKFWTKEEHKSFLYGLEVYGRGDWKNISKHFVTTKTPVQVSSHAQKF 310
                      678******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.721259315IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-9263317IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-13263313IPR006447Myb domain, plants
SuperFamilySSF466896.39E-16263316IPR009057Homeodomain-like
SMARTSM007171.8E-10263313IPR001005SANT/Myb domain
PfamPF002491.4E-8267309IPR001005SANT/Myb domain
CDDcd001676.81E-9267311No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDPIVNQGWT SSEVEEACSL IAMLNTNKIM YDSNDDKNKK HNYIVNSLHA LFPSKTMKQV  60
TDLYVDLAVE MHMTQWREGT HVTSGSPQNI FTFCDPFNGN YELPMEENGA SSTHGIYTMG  120
DHANENFGVR EEATIMDNNG LSFGCPMENT GITVTGEAPL MADSNKMEVL ENNISIDQPV  180
VAAHQWGFWT DEEHSMGGLV NENFEAQEDE DTTMDDNGFS FRCRLEDTRI RKTEEAPMMV  240
DKNKMVVLEN NTSVDRPAVA AHQRKFWTKE EHKSFLYGLE VYGRGDWKNI SKHFVTTKTP  300
VQVSSHAQKF FKRIQKKASS GTKRYSINDV RLHDNELLAA NNNSVTRQAL SFTGLNNDPS  360
FKLQAPTSSL TVMNNQAQCS PSIYNQQVGH QPMWSEQQMM GSVAAVMDGV GNYVPDGQQG  420
SAYFYLGNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM7ZP120.0M7ZP12_TRIUA; Transcription factor MYB1R1
STRINGMLOC_51337.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.17e-20MYB family protein